PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009605654.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family FAR1
Protein Properties Length: 217aa    MW: 24961.3 Da    PI: 10.4581
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009605654.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR164.52.8e-2051136290
            FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                     +Y+eYA ++GF +r+ +s+ks+r+g+i++r + C     ++++    + ++++r   r gC+a++ vk+ek g+w+v k++ +HnH+l+
  XP_009605654.1  51 YYDEYAGRAGFITRVLSSRKSERDGSIISRGLGCRGIPDNQRSG---SIANQKRDRRRDGCTAMILVKREKPGTWVVRKFVRDHNHPLV 136
                     8*********************************7555555544...4588999999******************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031014.3E-1851136IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MMTMDVQISE DSGARRLESS AIGQVSTSEV DRTQEPYEGM IFESEEAARA YYDEYAGRAG  60
FITRVLSSRK SERDGSIISR GLGCRGIPDN QRSGSIANQK RDRRRDGCTA MILVKREKPG  120
TWVVRKFVRD HNHPLVISPS KRRPTFDEKD KKIQELTAEL RIKKRLSAAY REQLLSLMKD  180
VDSHSEHMST KVQAVRRILK ELETKKQELS NRSRHHK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755181e-161HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009605654.11e-160PREDICTED: protein FAR1-RELATED SEQUENCE 2-like isoform X1
TrEMBLM1CKJ41e-136M1CKJ4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000694931e-136(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA130991718
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43280.14e-48FAR1 family protein